SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024348 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024348
Domain Number 1 Region: 27-128
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-28
Family Second domain of FERM 0.0021
Further Details:      
 
Domain Number 2 Region: 129-282
Classification Level Classification E-value
Superfamily PH domain-like 4e-24
Family Third domain of FERM 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024348   Gene: ENSGGOG00000010265   Transcript: ENSGGOT00000033711
Sequence length 444
Comment pep:known_by_projection chromosome:gorGor3.1:6:169194707:169206953:-1 gene:ENSGGOG00000010265 transcript:ENSGGOT00000033711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLRASRVTKTFLRRILRLTSRTELQGDHRARHLYYCHLKERVLRSQCAHREEAYFLLAAW
ALQADLGEHREPAHAGRYFEPHSYFPQWIITKRGIDYILRHMPTLHRERQGLSPKEAMLC
FIQEACRLEDVPVHFFRLHKDKKEGHPTVILGLALRGVHIYQEVDRAPQLLYDLPWPHVG
KLAFLGKKLEIQLDGLPAAQKLVYYTGCTWRSRHLLHLLRASHQLHLRVRPTLQQLRQRE
EAEEKQHYRESYISDGLELDLASRSFPGSGVSSQHCPRCLSRHSADSHGNSYTSGIKANS
WLRESREMSVDVPLEVHGLHEKEPSSSPRTSRSHPSTRGDSQATRQEPCTEVRTRGQSAE
AVHQIQEMKAGVSEEQHSHGLDDMQLHQLALHPAPASLSHTFHCALDCRLAGPCETRATL
PSKRSSNCLALDLFGETPPQEFVV
Download sequence
Identical sequences ENSGGOP00000024348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]