SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024675 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024675
Domain Number 1 Region: 42-160
Classification Level Classification E-value
Superfamily E set domains 0.000000294
Family ML domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024675   Gene: ENSGGOG00000024223   Transcript: ENSGGOT00000033213
Sequence length 162
Comment pep:known_by_projection chromosome:gorGor3.1:6:6746644:6812837:1 gene:ENSGGOG00000024223 transcript:ENSGGOT00000033213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSK
QLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQI
YYAGPVNNPEFTIPQGEYQVLLELYTEKRSTVACVNATITCS
Download sequence
Identical sequences G3S9B0
ENSGGOP00000024675 XP_004043284.1.27298 ENSGGOP00000024675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]