SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024817 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024817
Domain Number 1 Region: 6-216
Classification Level Classification E-value
Superfamily SGNH hydrolase 4.43e-63
Family Acetylhydrolase 0.00000000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024817   Gene: ENSGGOG00000013243   Transcript: ENSGGOT00000029692
Sequence length 231
Comment pep:known_by_projection chromosome:gorGor3.1:19:39628794:39634625:-1 gene:ENSGGOG00000013243 transcript:ENSGGOT00000029692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRE
LFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAI
VQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRVALAGHPRAHFLDADPGFVH
SDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
Download sequence
Identical sequences G3S9P9
ENSGGOP00000012918 XP_004060888.1.27298 XP_004060889.1.27298 ENSGGOP00000012918 ENSGGOP00000024817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]