SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024880 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024880
Domain Number 1 Region: 126-216
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.64e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 288-363
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.92e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000429
Further Details:      
 
Domain Number 3 Region: 40-114
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.45e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024880   Gene: ENSGGOG00000003683   Transcript: ENSGGOT00000034402
Sequence length 371
Comment pep:known_by_projection chromosome:gorGor3.1:21:34565650:34666293:1 gene:ENSGGOG00000003683 transcript:ENSGGOT00000034402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEGDAFWAPSVLPHSTLSALSHHPQPQFGRRMESKVSEGGLNVTLTIRLLMHGKEVGSI
IGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMS
NSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTI
SGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPASTPVIFAGGQAYTIQGQYAIPHPDQ
LTKLHQLAMQQTPFPPLGQTNPAFPGTYPALFSPPSPNHVPLVYPGLDASPPASTHELTI
PNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITITGTPANISLAQYLINAR
LTSEVTGMGTL
Download sequence
Identical sequences ENSGGOP00000024880 ENSGGOP00000003621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]