SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024937 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024937
Domain Number 1 Region: 21-240
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-62
Family Ankyrin repeat 0.00019
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024937
Domain Number - Region: 823-929
Classification Level Classification E-value
Superfamily t-snare proteins 0.00173
Family t-snare proteins 0.0057
Further Details:      
 
Domain Number - Region: 428-507
Classification Level Classification E-value
Superfamily Tropomyosin 0.00451
Family Tropomyosin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024937   Gene: ENSGGOG00000024320   Transcript: ENSGGOT00000021985
Sequence length 958
Comment pep:known_by_projection chromosome:gorGor3.1:17:58903416:59055590:-1 gene:ENSGGOG00000024320 transcript:ENSGGOT00000021985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLKAKFRKSDTNEWNKNDDRLLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLA
AAKGHVECLRVMVTHGVDVTAQDTTGHSALHLAAKNSHHECIRKLLQSKCPAESVDSSGK
TALHYAAAQGCLQAVQILCEHKSPINLKDLDGNIPLLLAVQNGHSEICHFLLDHGADVNS
RNKSGRTALMLACEIGSSNVVEALIKKGADLNLVDSLGHNALHYSKLSENAGIQSLLLSK
ISQDADLKTPTKPKQHDQVSKISSERSGTPKKRKAPPPPISPTQLSDVSSPRSITSTPLS
GKESVFFAEPPFKAEISSIQENKDRLSDSTTGADSLLDISSEADQQDLLSLLQAKVASLT
LHNKELQDKLQAKSPKEAEADLSFDSYHSTQTDLGPSLGKPGETSPPDSKSSPPVLIHSL
GKSTTDNDVRIQQLQEILQDLQKRLESSEAERKQLQVELQSRRAELVCLNNTEISENSSD
LSQKLKETQSKYEEAMKEVLSVQKQMKLGLVSPESMDNYSHFHELRVTEEEINVLKQDLQ
NALGTVIKPPVEEYEEMKSSYCSVIENMNKEKAFLFEKYQEAQEEIMKLKDTLKSHMTQE
ASDEAEDMKEAMNRMIDELNKQVSELSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHE
KLMQLTNVSRAKAEDALSEMKSQYSKVLNELTQLKQLVDAQKENSVSITEHLQVITTLRT
AAKEMEEKISNLKEHLASKEVEVAKLEKQLLEEKAAMTDAMVPRSSYEKLQSSLESEVSV
LASKLKESVKEKEKVHSEVVQIRSEVSQVKREKENIQTLLKSKEQEVNELLQKFQQAQEE
LAEMKRYSESSSKLEEDKDKKINEMSKEVTKLKEALNSLSQLSYSTSSSKRQSQQLEALQ
QQVKQLQNQLAECKKQHQEVISVYRMHLLYAVQGQMDEDVQKVLKQILTMCKNQSQKK
Download sequence
Identical sequences ENSGGOP00000024937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]