SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025158 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025158
Domain Number 1 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 421-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 477-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-20
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 9-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-19
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 5 Region: 305-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-16
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 6 Region: 249-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000154
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000025158
Domain Number - Region: 210-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00039
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 134-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00073
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025158   Gene: ENSGGOG00000027812   Transcript: ENSGGOT00000033580
Sequence length 540
Comment pep:known_by_projection chromosome:gorGor3.1:19:54925168:54931382:1 gene:ENSGGOG00000027812 transcript:ENSGGOT00000033580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVLMDRVQSCVTFEDVFVYFSREEWELLEEAQRFLYRDVMLENFALVATLAFIFPVP
CSCAVGGGRKPWVPDRADITAATVKETYRGHGPAEWELEEGFWCEAEHEAPSEQSVFVEG
VSQVRTAESGLFQKAHPCEMCDPLLKDILHLAEHQGSHLTQKLCTRGLCRRFSFSANFYQ
HQKQHNGENCFRGDDGGASFVKSCTVHMLGRSFTCREEGMDLPDSSGLFQHQTTYNRVSP
CRRTECMESFPHSSSLRQHQGDYDGQMLFSCSDEGKAFLDTFTLLDSQMTHAEVRPFRCL
PCGNVFKEKSAVINHRKIHSGETSHVCKECGKAFIHLHHLKMHHKFHTGKRHYTCSECGK
AFGSFGYKDTLVQHQKIHTGERPYECGECGKFFSHSSNLIVHQRIHTGAKPYECNECGKC
FSHNSSLILHQRVHTGARPYVCSECGKAYISSSHLVQHKKVHTGARPYECSECGKFFSRN
SGLILHQRVHTGEKPYVCSECGKAYSRSSHLVRHQKAHTGERAHECNSFGDPLAASLKLV
Download sequence
Identical sequences ENSGGOP00000025158 ENSGGOP00000025158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]