SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025250 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025250
Domain Number 1 Region: 111-190
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000112
Further Details:      
 
Domain Number 2 Region: 206-298
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.31e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000128
Further Details:      
 
Domain Number 3 Region: 400-491
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.06e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000148
Further Details:      
 
Domain Number 4 Region: 299-390
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025250   Gene: ENSGGOG00000027554   Transcript: ENSGGOT00000030348
Sequence length 666
Comment pep:known_by_projection chromosome:gorGor3.1:1:80231612:80263364:-1 gene:ENSGGOG00000027554 transcript:ENSGGOT00000030348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGY
GGQKRPLEDGDGSWTSPSSTTHWEGMPSPFKDQPDAKKVAPQNDSFGTQLPPMHQQQSRS
VMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGLPERSCMLTGTPESVQS
AKRLLDQIVEKGRPAPGFHHGDGPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKM
VMIQDGPQNTGADKPLRITGDPYKVQQAKEMVLELIRDQGGFREVRNEYGSRIGGNEGID
VPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEII
TDLLRSVQAGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETI
KSISQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVP
HGPHGVPGPHGPPGPPGPGTPMGPYNPAPYNPGPPGPAPHGPPAPYAPQGWGNAYPHWQQ
QAPPDPAKAGTDPNSAAWAAYYAHYYQQQAQPPPAAPAGAPTTTQTNGQEGDQQNPAPAG
QVDYTKAWEEYYKKMGQAVPAPTGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHP
PAPQGQ
Download sequence
Identical sequences ENSGGOP00000017520 ENSGGOP00000025250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]