SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025344 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025344
Domain Number 1 Region: 1040-1152
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-47
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000552
Further Details:      
 
Domain Number 2 Region: 1255-1358
Classification Level Classification E-value
Superfamily SRCR-like 6.8e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 484-589
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00029
Further Details:      
 
Domain Number 4 Region: 46-152
Classification Level Classification E-value
Superfamily SRCR-like 1.06e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00055
Further Details:      
 
Domain Number 5 Region: 163-267
Classification Level Classification E-value
Superfamily SRCR-like 6.15e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00051
Further Details:      
 
Domain Number 6 Region: 591-696
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00034
Further Details:      
 
Domain Number 7 Region: 269-375
Classification Level Classification E-value
Superfamily SRCR-like 7.46e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00064
Further Details:      
 
Domain Number 8 Region: 802-907
Classification Level Classification E-value
Superfamily SRCR-like 6.54e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0018
Further Details:      
 
Domain Number 9 Region: 377-481
Classification Level Classification E-value
Superfamily SRCR-like 7.72e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00055
Further Details:      
 
Domain Number 10 Region: 698-803
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 11 Region: 907-1012
Classification Level Classification E-value
Superfamily SRCR-like 7.32e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0011
Further Details:      
 
Domain Number 12 Region: 1147-1254
Classification Level Classification E-value
Superfamily SRCR-like 5.75e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025344   Gene: ENSGGOG00000026018   Transcript: ENSGGOT00000022969
Sequence length 1463
Comment pep:known_by_projection chromosome:gorGor3.1:12:7549897:7650155:-1 gene:ENSGGOG00000026018 transcript:ENSGGOT00000022969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLPQNSWHIDFGRCCCHQNLFSAVVTCILLLNSCFLISSFNGTDLELRLVNGDGPCSGT
VEVKFQGQWGTVCDDGWNTTASTVVCKQLGCPFSFAMFRFGQAVTRHGKIWLDDVSCYGN
ESALWECQHREWGSHNCYHGEDVGVNCYGKSLTRVGRQGEANLGLRLVDGNNSCSGRVEV
KFQERWGTICDDGWNLNTAAVVCRQLGCPSSFISSGVVNSPAVLRPIWLDDILCQGNELA
LWNCRHRGWGNHDCSHNEDVTLACYDSSDLELRLVGGTNRCMGRVELKIQGRWGTVCHHK
WNNAAADVVCKQLGCGTALHFAGLPHLQSGSDVVWLDGVSCSGNESFLWDCRHSGTVNFD
CLHQNDVSVICSDGADLELRLADGSNNCSGRVEVRIHEQWWTICDQNWKNEQALVVCKQL
GCPFSVFGSRRAKPSNEARDIWINSISCTGNESALWDCTYDGKAKRTCFRRSDAGVICSD
KADLDLRLVGAHSPCYGRLEVKYQGEWGTVCHDRWSTRNAAVVCKQLGCGKPVHVFGMTY
FKEASGPIWLDDVSCIGNESNIWDCEHSGWGKHNCVHREDVIVTCSGNATWGLRLVGGSN
RCSGRLEVYFQGRWGTVCDDGWNSKAAAVVCSQLDCPSSIIGMGLGNASTGYGKIWLDDV
SCDGDESDLWSCRNSGWGNNDCSHSEDVGVICSDASDMELRLVGGSSRCAGKVEVKVQGA
VGILCANGWGMNIAEVVCRQLECGSAIRVSREPHFTERTLHILMSNSGCTGGEASLWDCI
RWEWKQTACHLNMEASLICSAHRQPRLVGADMPCSGRVEVKHADTWRSVCDSDFSLHAAN
VLCRELNCGDAISLSVGDHFGKGNGLTWAEKFQCEGSETHLALCPIVQHPEDTCIHSREV
GVVCSRYTDVRLVNGKSQCDGQVEINVLGHWGSLCDTHWDPEDARVLCRQLSCGTALSTT
GGKYIGERSVRVWGHRFHCLGNESLLDNCQMTVLGAPPCIHGNTVSVICTGSLTQPLFPC
LANVSDPYLSAVPEGSALICSEDKRLRLVDGDSRCAGRVEIYHDGFWGTICDDGWDLSDA
HVVCRKLGCGVALNATVSAPFGEGSGPIWLDDLNCTGTESHLWQCPSRGWGQHDCRHKED
AGVICSEFTALRLYSETETESCAGRLEVFYNGTWGSVGRRNITTAIAGIVCRQLGCGENG
VVSLAPLSKTGSGFMWVDDIQCPKTHISIWQCLSAPWERRISSPAEETWITCEDRIRVRG
GDTECSGRVEIWHAGSWGTVCDDSWDLAEAEVVCQQLGCGSALAALRDASFGQGTGTIWL
DDMRCKGNESFLWDCHAKPWGQSDCGHKEDAGVRCSGQSLKSLNASSGHLALILSSIFGL
LLLVLFILFLTWCRVQKQKHLPLRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSDDTP
NHGCEDASDTSLLGVLPASEATK
Download sequence
Identical sequences G3SB70
ENSGGOP00000025344 XP_018895005.1.27298 ENSGGOP00000025344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]