SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025665 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025665
Domain Number 1 Region: 224-400
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.06e-68
Family SMAD domain 0.00012
Further Details:      
 
Domain Number 2 Region: 76-175
Classification Level Classification E-value
Superfamily SMAD MH1 domain 2.75e-31
Family SMAD MH1 domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025665   Gene: ENSGGOG00000013002   Transcript: ENSGGOT00000025926
Sequence length 401
Comment pep:known_by_projection chromosome:gorGor3.1:15:46035720:46113724:1 gene:ENSGGOG00000013002 transcript:ENSGGOT00000025926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRSKRSGLVRRLWRSRVVPDREEDGSLGSRAEPAPRPGGPGWLPESDCETVTCCLFSER
DASREARSRLLLLEQELKTVTYSLLKRLKERSLDTLLEAVESRGGVPGGCVLVPRADLRL
GGQPAPPQLLLGRLFRWPDLQHAVELKPLCGCHSFAAAADGPTVCCNPYHFSRLCGPESP
PPPYSRLSPRDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVA
YWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSK
EPDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGLQHAPEPDAA
DGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEILLNNPR
Download sequence
Identical sequences ENSGGOP00000025665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]