SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025669 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025669
Domain Number 1 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.41e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.81e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.63e-25
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.96e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 506-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.42e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 202-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025669   Gene: ENSGGOG00000023048   Transcript: ENSGGOT00000034058
Sequence length 563
Comment pep:known_by_projection chromosome:gorGor3.1:5:163582229:163590874:1 gene:ENSGGOG00000023048 transcript:ENSGGOT00000034058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRLLPAHVQESVTFRDVAVFFSQDEWLHLDSAQRALYREVMLENYSILVSLGILFSKP
KVISQLEQGEDPWMVESGVPQGAHLGWESLFETIVSKEENQEVMKKLIIDGAFDFKLEKT
YINEDKLEKQQGKKNRLFSKVLVTIKKVYMKERSFKGVEFGKNLGLKSSLIRKPRLVSRG
RRPRSQQYSVLFKQLGVNTVRKCYKCNICGKIFLHSSSLSKHQRIHTGEKLYKCKECRKA
FSQSSSLTQHLRVHTGEKPYICSECGKAFSFTTSLIGHQRMHTGERPYKCKECGKTFKGS
SSLNNHQRIHTGEKPYKCNECGRAFSQCSSLIQHHRIHTGEKPYECTQCGKAFTSISRLS
RHHRIHTGEKPFHCNECGKVFSYHSALIIHQRIHTGEKPYACKECGKAFSQSSALIQHQR
IHTGEKPYKCNECGKAFSWISRLNIHHRIHTGEKPYNCKECGKAFSSHSGVNTHRKIHTG
EKPYKCNDCEKAFNQSSALIQHQRIHTGEKPYNCKVCGKAFRQSSSLMTHMRIHTGEKPY
KCKECGKAFSQSSSLTNHQRTHN
Download sequence
Identical sequences G3S2S2
ENSGGOP00000025669 ENSGGOP00000025669 XP_004043174.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]