SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025683 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025683
Domain Number 1 Region: 350-408
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000707
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025683   Gene: ENSGGOG00000017041   Transcript: ENSGGOT00000023270
Sequence length 453
Comment pep:known_by_projection chromosome:gorGor3.1:20:61067341:61090794:-1 gene:ENSGGOG00000017041 transcript:ENSGGOT00000023270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPPGGPREPPPEAGAAGGEAGVEGAGGGDAALGEPGLSFTTTDLSLVEMTEVEYTQLQH
ILYSHMEAAADGELETRLNSALPVYPVLCPSALAADAPCLGHIDFQELRMMLLSEAGAAE
KTSGGGDGTRAREXAVRVRLEDRFNSNSWEPCAPGGALGCQACFCLGSLVTLIRHPSELV
NVPLHQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTSGNSNLSQTQSSSNSCSILE
AAKHQDIGLPRAFSFCYQQEIESTKQTLGSRNKVLPEQVWIKVGEEALCKQALKRNRSRM
RQLDTNVERRALGEIQNVGEGATATQGSWQSSESSQANLGEQAQSGPQGGRSQRRERHNR
MERDRRRRIRICCDELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFC
GKTGRRLKLTRPDSLVTCPAQGSLQSSPPVEIK
Download sequence
Identical sequences ENSGGOP00000025683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]