SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025717 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025717
Domain Number 1 Region: 227-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.79e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 171-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-22
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 325-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 6-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.71e-19
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 6 Region: 378-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000741
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025717   Gene: ENSGGOG00000003544   Transcript: ENSGGOT00000003561
Sequence length 407
Comment pep:novel chromosome:gorGor3.1:19:53918499:53923308:1 gene:ENSGGOG00000003544 transcript:ENSGGOT00000003561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPVIYLGSSKFQDVAIDFSKEEWGFLNPAQRDLYTTVMLENYQNLVWLGLSISKSVISLL
EKRKLPWLMGKEEIRGPLPGLEPKAKTRTLFGKGMCFRDSSPSGVTQESLFKSIETCSEF
TFEWTLRNGSRRNRKHPVLFQGLTIHEEKVPKFDTVIKCTRNERIHTGEKTFSQMTHLTQ
HQTTHTREKFHECSECGKAFSRFSALIDHQRIHTGEKPYECKECGRAFTQSAQLIRHQKT
HSGEKPYECSECKKSFVRLSSLIEHWRIHTGEKPYQCKDCKKTFCRVMQFTLHRRIHTGE
KPYECKECGKSFSAHSSLVTHKRTHSGEKPYKCKECGKAFSAHSSLVTHKRTHSGEKPYK
CHACGKAFNTSSTLCQHNIHTGEKPFQCSQCGKSFSCSSHLTRHCRM
Download sequence
Identical sequences ENSGGOP00000025717 ENSGGOP00000025717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]