SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025771 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025771
Domain Number 1 Region: 460-556
Classification Level Classification E-value
Superfamily PH domain-like 8.4e-28
Family Pleckstrin-homology domain (PH domain) 0.0096
Further Details:      
 
Domain Number 2 Region: 639-758
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-22
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 3 Region: 1042-1111,1154-1198
Classification Level Classification E-value
Superfamily Second domain of FERM 5.35e-18
Family Second domain of FERM 0.0082
Further Details:      
 
Domain Number 4 Region: 576-631
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000129
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 5 Region: 422-460
Classification Level Classification E-value
Superfamily PH domain-like 0.000000107
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 6 Region: 4-60
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000398
Family Motor proteins 0.027
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000025771
Domain Number - Region: 91-177,462-487
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000743
Family BAR domain 0.046
Further Details:      
 
Domain Number - Region: 949-1035
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0124
Family Ras-binding domain, RBD 0.024
Further Details:      
 
Domain Number - Region: 1202-1288
Classification Level Classification E-value
Superfamily PH domain-like 0.0189
Family Third domain of FERM 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025771   Gene: ENSGGOG00000007641   Transcript: ENSGGOT00000032792
Sequence length 1306
Comment pep:known_by_projection chromosome:gorGor3.1:17:77126206:77164859:1 gene:ENSGGOG00000007641 transcript:ENSGGOT00000032792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSFIFRKQYRKVLYCVVIIQKNYRAFLLRRRFLHLKKAAIVFQKQLRGQIARRVYRQLL
AQKSQQMPQNLQFETVTLGKAVLKRERERERREAELRAQQEEETRKQQELEALQKSQTEA
ELTRELEKQKENKQVEEILRLEKEIEDLQRMKEQQELSLTEASLQKLQERRDQELRRLEE
EACRAAQEFLESLNFDEIDECVRNIERSLSVGSEFSSELAESACEEKPNFNFSQPYPEEE
VDEGFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDDSSEEDPYMNDTVVPTSPSADSTVL
LAPSVQDSGSLHNSSSGESTYCMPQNAGDLPSPDGDYDYDQDDYEDGAITSGSSVTFSNS
YGSQWSPDYRCSVGTYNSSGAYRFSSEGAQSSFEDSEEDFDSRFDTDDELSYRRDSVYSC
VTLPYFHSFLYMKGGLMNSWKRRWCVLKDETFLWFRSKQEALKQGWLHKKGGGSSTLSRR
NWKKRWFVLRQSKLMYFENDSEEKLKGTVEVRTAKEIIDNTTKENGIDIIMADRTFHLIA
ESPEDASQWFSVLSQVHASTDQEIQEMHDEQANPQNAVGTLDVGLIDSVCASDSPDRPNS
FVIITANRVLHCNADTPEEMHHWITLLQRSKGDTRVEGQEFIVRGWLHKEVKNSPKMSSL
KLKKRWFVLTHNSLDYYKSSEKNALKLGTLVLNSLCSVVPPDEKIFKETGYWNVTVYGRK
HCYRLYTKLLNEATRWSSAIQNVTDTKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRNPI
LRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLESMSDPIPIIQGI
LQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFH
LKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSC
KITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLA
ATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAA
LRLQYLQGDYTLHAAVPPLEEVYSLQRLKARISQSTKTFTPCERLEKRRTSFLEGTLRRS
FRTGSVVRQKVEEEQMLDMWIKEEVSSARASIIDKWKKFQGMNQEQAMAKYMALIKEWPG
YGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKI
VVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTTRSASSQGSSR
Download sequence
Identical sequences ENSGGOP00000025771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]