SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025778 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025778
Domain Number 1 Region: 457-532,599-781
Classification Level Classification E-value
Superfamily RNI-like 3.53e-25
Family 28-residue LRR 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025778   Gene: ENSGGOG00000010618   Transcript: ENSGGOT00000031386
Sequence length 812
Comment pep:known_by_projection chromosome:gorGor3.1:1:47914491:47938616:-1 gene:ENSGGOG00000010618 transcript:ENSGGOT00000031386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPEAWRARSCWFCEVAAATTMEATSREAAPAKSSASGPNAPPALFELCGRAVSAHMGV
LESGVWALPGPILQSILPLLNIYYLERIEETALKKGLSTQAIWRRLWDELMKTRPSSLES
VTCWRAKFMEAFFSHVLRGTIDVSSDRRLCDQRFSPLLHSSRHVRQLTICNMLQGATELV
AEPNRRVLETLASSLHTLKFRHLLFSDVAAQQSLRQLLHQLIHHGAVSQVSLYSWPVPES
ALFILILTMSAGFWQPGPGGPPCRLCGEASRGRAPSRDEGSLLLGSRRPRRDAAERCAAA
LMASRRKSEAKQMPRAAPATRVTRRSTQESLTAGGTDLKRELHPPATSHEAPGTKRSPSA
PAATSSASSSTSSYKRAPASSAPQPKPLKRFKRAAGKKGARTRQGPGAESEDLYDFVFIV
AGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRFRSISTLELFTVPLSTEAALTL
CHLLSSWVSLESLTLSYNGLGSNIFRLLDSLRALSGQAGCRLRALHLSDLFSPLPILELT
RAIVRALPLLRVLSIRVDHPSQRDNPGVPGNAGPPSHIIGDEEIPENCLEQLEMGFPRGA
QPAPLLCSVLKASGSLQQLSLDSATFASPQDFGLVLQTLKEYNLALKRLSFHDMNLADCQ
SEVLFLLQNLTLQEITFSFCRLFEKRPAQFLPEMVAAMKGNSTLKGLRLPGNRLGNAGLL
ALADVFSEDSSSSLCQLDISSNCIKPDGLLEFAKRLERWGRGAFGHLRLFQNWLDQDAVT
AREAIRRLRATCHVVSDSWDSSQAFADYVSTM
Download sequence
Identical sequences G3SCF0 H2PYY6 Q15345
ENSP00000343298 ENSP00000343298 ENSP00000477792 ENSGGOP00000025778 NP_006360.3.87134 NP_006360.3.92137 XP_004025768.1.27298 XP_513144.3.37143 ENSPTRP00000001199 ENSPTRP00000001199 gi|38569471|ref|NP_006360.3| 9606.ENSP00000343298 ENSP00000343298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]