SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025940 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025940
Domain Number 1 Region: 271-346
Classification Level Classification E-value
Superfamily RING/U-box 1.24e-24
Family Variant RING domain 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025940   Gene: ENSGGOG00000023481   Transcript: ENSGGOT00000023099
Sequence length 359
Comment pep:known_by_projection chromosome:gorGor3.1:1:214874529:214876202:-1 gene:ENSGGOG00000023481 transcript:ENSGGOT00000023099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STALGAHKRPASVSSSAAVEHEQREAAAKEKQPPPPAHRGPADSLSTAAGAAELSAEGAG
KSRGSGEQDWVNRPKTVRDTLLALHQHGHSGPFESKFKKEPALTAGRLLGFEANGANGSK
AVARTARKRKPSPEPEGEVGPPKINGEAQPWLSTSTEGLKIPMTPTSSFVSPPPPTASPH
SNRTTPPEAAQNGQSPMAALILVADNAGGSHASKDANQVHSTTRRNSNSPPSPSSMNQRR
LGPREVGGQGAGNTGGLEPVHPASLPDSSLAASAPLCCTLCHERLEDTHFVQCPSVPSHK
FCFPCSRQSIKQQGASGEVYCPSGEKCPLVGSNVPWAFMQGEIATILAGDVKVKKERDS
Download sequence
Identical sequences A0A2I2ZN68
ENSGGOP00000025940 ENSGGOP00000025940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]