SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025973 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025973
Domain Number 1 Region: 100-372
Classification Level Classification E-value
Superfamily L domain-like 1.79e-48
Family Ngr ectodomain-like 0.0036
Further Details:      
 
Domain Number 2 Region: 53-120
Classification Level Classification E-value
Superfamily L domain-like 0.000000748
Family Ngr ectodomain-like 0.0037
Further Details:      
 
Domain Number 3 Region: 441-510
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000164
Family Fibronectin type III 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025973   Gene: ENSGGOG00000023646   Transcript: ENSGGOT00000030509
Sequence length 674
Comment pep:known_by_projection chromosome:gorGor3.1:11:60903212:60917322:1 gene:ENSGGOG00000023646 transcript:ENSGGOT00000030509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVAHPTATATTTPTATVTATVVMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRC
DNGFIYCNDRGLTSIPTDIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDE
FPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLK
LLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIA
DDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLD
LSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGP
EKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLR
LPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPAASFRLSWLRLGHSPAVGSI
TETLVQGDKTEYLLTALEPKSTYIICMVTMETGNAYVADETPVCAKAETADSYGPTTTLN
QEQNAGPMASLPLAGIIGGAVALVFLFLVLGAICWYVHQAGELLTRERAYNRGSRKKDDY
MESGTKKDNSILEIRGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKATHTIGYGTTRG
YRDGGIPDIDYSYT
Download sequence
Identical sequences G3SCZ5
XP_004051466.1.27298 ENSGGOP00000025973 ENSGGOP00000025973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]