SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025992 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025992
Domain Number 1 Region: 265-528
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.14e-81
Family STAT DNA-binding domain 0.00032
Further Details:      
 
Domain Number 2 Region: 529-648
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-35
Family SH2 domain 0.00024
Further Details:      
 
Domain Number 3 Region: 112-273
Classification Level Classification E-value
Superfamily STAT 1.35e-26
Family STAT 0.0046
Further Details:      
 
Domain Number 4 Region: 1-115
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.44e-25
Family Transcription factor STAT-4 N-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025992   Gene: ENSGGOG00000001424   Transcript: ENSGGOT00000029672
Sequence length 847
Comment pep:known_by_projection chromosome:gorGor3.1:12:55210727:55227948:-1 gene:ENSGGOG00000001424 transcript:ENSGGOT00000029672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGNDAFCCNVASALLSDT
VQHLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMP
FHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAEAGQVPLHSLIETPANGTGPSEALA
MLLQETTGELEAAKALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
EIGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWDKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLSIEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE
LQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQE
PHVPLLPGLAPLSLFPLLVPGRGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAF
PQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMD
LRTNPSW
Download sequence
Identical sequences ENSGGOP00000001410 ENSGGOP00000025992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]