SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026044 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026044
Domain Number 1 Region: 37-200
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-32
Family Dual specificity phosphatase-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026044   Gene: ENSGGOG00000011019   Transcript: ENSGGOT00000032567
Sequence length 212
Comment pep:known_by_projection chromosome:gorGor3.1:10:87710628:87730561:-1 gene:ENSGGOG00000011019 transcript:ENSGGOT00000032567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWP
KLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTLPTVWIDSLAEKQGITPCFLLSMF
FVLIDWFQNSPGNLSHCKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVL
PNRGFLKQLRELDKQLVQQRQQAQRQDGEEED
Download sequence
Identical sequences ENSGGOP00000026044 ENSGGOP00000026044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]