SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026068 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026068
Domain Number 1 Region: 211-322
Classification Level Classification E-value
Superfamily HSP20-like chaperones 3.49e-35
Family GS domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026068   Gene: ENSGGOG00000027396   Transcript: ENSGGOT00000034706
Sequence length 332
Comment pep:known_by_projection chromosome:gorGor3.1:11:87473652:87500408:-1 gene:ENSGGOG00000027396 transcript:ENSGGOT00000034706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCT
KGRHNSEKPPEPVKPEVKNTEKKELSELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLEL
KISASLKQALDKLKLSSGNEENKKEEDNDEIKIGTSCKNGGCSKTYRGPESLEEVCVYHS
GVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVPCRHDWHQTGGE
VTISVYAKNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKI
EITMRKAEPMQWASLELPAAKKQEKQKDDTTD
Download sequence
Identical sequences G3SD88
XP_004052009.2.27298 ENSGGOP00000026068 ENSGGOP00000026068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]