SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026257 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026257
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily RING/U-box 1.58e-38
Family RING finger domain, C3HC4 0.00000264
Further Details:      
 
Domain Number 2 Region: 1608-1732
Classification Level Classification E-value
Superfamily BRCT domain 1.11e-16
Family BRCT domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026257   Gene: ENSGGOG00000009827   Transcript: ENSGGOT00000031061
Sequence length 1732
Comment pep:known_by_projection chromosome:gorGor3.1:5:40890772:40964186:1 gene:ENSGGOG00000009827 transcript:ENSGGOT00000031061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKD
EVSIIQSTGYRSRAKRLLQSEPENPSLQETGLSVQLSNLGTVRTLRTKQRIQPQKKSVYI
ELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQ
PSNNDLNTTEKRATERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVE
KAEFCNKNKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERNEWNKQKLPC
SENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGGSESNAKVADVLDVLNEVD
EYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRRKASLPSLSHVTEN
LIIGAFVTEPQIIQERPLTNKLKRKRRATSGLHPEDFIKKADLAVQKTPEMINQGTNQME
QNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNI
HNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPV
RHSRNLQLMEDKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTNCSNTSELKE
FVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQ
ESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDTRNDTEGFKYPLGHEVNHS
RETSIEMEESELDAQYLQNTFKVSKRQSFALFSNPGNPEEECATFSAHSRSLKKQSPKVT
FECEQKEENQGKNESNIKPVQTVNITAGFPVVCQKDKPVDYAKCSIKGGSRFCLSSQFRG
NETGLITPNKHGLLQNPYHIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIP
STVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEVGSSDENIQAELGRNRGPKL
NAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPCLISDNLEQPMGSS
HASQVCSETPDDLLDDGEIKEDTSFAKNDIKESSAVFSKSVQRGELSRSPSPFTHTHLAQ
GYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVSNIPSQSTRHSTVATECLSKNTEENL
LSLKNSLNDCSNQVILAKTSQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGS
SKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSE
DCSGLSSQSDILTTQQRDTMQDNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALE
DLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERRSGSP
CPNLGDRARLHLASLLLENESNPKAEKSNGVITLDEETKIKHLPHFSTFFSFLTKLLLEG
TPYLESGISLFSDDPESDPSEDRAPESAHVGNIPSSTSALKVPQLKVAESAQSPAAAHTT
NTAGYHAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFLLLYRKFKRKSFLTLSNA
VKQKTSKIILPSNAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKEGKMLNE
Download sequence
Identical sequences ENSGGOP00000026257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]