SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026261 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026261
Domain Number 1 Region: 327-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.85e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 481-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 279-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 2-49
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-20
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 7 Region: 161-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000144
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 8 Region: 221-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000012
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026261   Gene: ENSGGOG00000023227   Transcript: ENSGGOT00000030053
Sequence length 539
Comment pep:known_by_projection chromosome:gorGor3.1:18:14352626:14377011:-1 gene:ENSGGOG00000023227 transcript:ENSGGOT00000030053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLTFRDVAIEFSPEEWKCLDPAQQNLYRDVMLENYRNLVSLAVYSYYNQGILPEQGIED
LFKKATLGRYGSCGLENICLWKNWASIGEGEGQKECYYLCSQYLTTSHNKHLTVKGDKEY
RIFQKKPQFLSAAPTEPCIPMNKYQHQFLKSVFCNKNQINFNHDSNISKHHSTHFLENYY
NCNECEKVFYQSSKLIFPENIHIQEKPYKSNECGETSDPFSKLTQHQRIYIGESSQRCNK
KCIIVFSQSHLKGHKIINTGEKSVKYKERGKAFTRGLHLGHQKIHTGEKPYKCKKCDKAF
NKSSHLAQHQRIHTGEKPFKCKECGKAFNRGSYLTQHQRIHTGERAFKCEECGKAFNRGS
YLTQHQRIHTGEKPFRCKECGKAFNRSSYVTQHQRMHTGEKPFKCKECGKAFNRASHLTQ
HQRIHTGEKHFKCKECGKAFNRGSHLTRHQRIHTGEKSFKCKECGKAFIWGSHLTQHQRI
HTGEKFFKCKECGKAFTRSSHLTQHQRIHTGEKPFKCKECGKAFNRRSTLTQHQIIHTR
Download sequence
Identical sequences ENSGGOP00000026261 ENSGGOP00000026261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]