SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026306 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026306
Domain Number 1 Region: 1-195
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 3.14e-51
Family Tubulin, GTPase domain 0.00013
Further Details:      
 
Domain Number 2 Region: 281-332,359-475
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 3.89e-24
Family Tubulin, C-terminal domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026306   Gene: ENSGGOG00000007246   Transcript: ENSGGOT00000033529
Sequence length 475
Comment pep:known_by_projection chromosome:gorGor3.1:5:23973914:24005036:1 gene:ENSGGOG00000007246 transcript:ENSGGOT00000033529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIVTVQLGQCGNQIGFEVFDALLSDSHSSQGLCSMRENEAYQASCKERFFSEEENGVPI
ARAVLVDMEPKVINQTLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYSVHGPRHEESIM
NIIRKEVEKCDSFSGFFIIMSMAGGTGSGLGAFVTQNLEDQYSNSLKMNQIIWPYGTGEV
WTFEINMVLARIHLGGATCSQWLHQEEGKGRVFLFQANFLLINLAEETNQVLGSHYGNIF
FPILKAHINFHVNRNDKKSISVLMFTLFSWSLHFFFFFTGDLMEHLVPHPEFKMLSVRNI
PHMSENSLAYSTFTWAGLLKHLRQMLISNAKMEEVGIDRHVRPPLSGLPPLSKMSLNKDL
HFNTSIANLVILRGKDVQSADVGKKFRAVYYFRINDPYSLYRKERDFKAYMKLFRHFSEF
ILHIGYMEKIKVGXRLNWFSTRAYIHQYTKFGIEEEDFLDSFTSLEQVVASYCNL
Download sequence
Identical sequences ENSGGOP00000007092 ENSGGOP00000026306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]