SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026351 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026351
Domain Number 1 Region: 336-407
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.79e-22
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 96-128
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000214
Family Intermediate filament protein, coiled coil region 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026351
Domain Number - Region: 208-324
Classification Level Classification E-value
Superfamily Prefoldin 0.00628
Family Prefoldin 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026351   Gene: ENSGGOG00000016851   Transcript: ENSGGOT00000023938
Sequence length 446
Comment pep:known_by_projection chromosome:gorGor3.1:5:42717794:42756081:1 gene:ENSGGOG00000016851 transcript:ENSGGOT00000023938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYAKPPPTINAIKGLRRKERLKPAHIHLQQLTCFSITCSSTMSYSCCLPSLGCRTSCSS
RPCVPPSCHGYTLPGACNIPANVSNCNWFCEGSFNGSEKETMQFLNDRLASYLEKVRQLE
RDNAELEKLIQERSQQQEPLLCPSYQSYFKTIEELQQKILCAKAENARLVVNIDNAKLAS
DDFRSKYQTEQSLRLLVESDINSIRRILDELTLCKSDLESQVESLREELICLKKNHEEEV
NTLRSQLGDRLNVEVDTAPTVDLNQVLNETRSQYEALVETNRREVEQWFATQTEELNKQV
VSSSEQLQSYQAEIIELRRTVNALEIELQAQHNLRDSLENTLTESEARYSSQLSQVQSLI
TNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRSLLESEDCKLPSNPCATTNAC
DKSTGPCISNPCGPRARCGPCNTFGY
Download sequence
Identical sequences ENSGGOP00000026351 ENSGGOP00000016435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]