SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026354 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026354
Domain Number 1 Region: 415-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 186-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 3 Region: 359-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-20
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 4 Region: 242-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 29-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-20
Family KRAB domain (Kruppel-associated box) 0.0028
Further Details:      
 
Domain Number 6 Region: 307-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 7 Region: 150-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000222
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026354   Gene: ENSGGOG00000025171   Transcript: ENSGGOT00000029126
Sequence length 505
Comment pep:known_by_projection chromosome:gorGor3.1:16:31356590:31362707:-1 gene:ENSGGOG00000025171 transcript:ENSGGOT00000029126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPSAPLPAQGPGKARPSRKRGRRPRALKFVDVAVYFSPEEWGCLRPAQRALYRDVMRE
TYGHLGALGCAGPKPALISWLERNTDDWEPAALDPQEYPRGLTVQRKSRTRKKNGEKEVF
PPKEAPRKGKRGRRPSKPRLIPRQTSGGPICPDCGCTFPDHQALESHKCAQNLKKPYPCP
DCGRRFSYPSLLVSHRRAHSGECPYVCDQCGKRFSQRKNLSQHQVIHTGEKPYHCPDCGR
CFRRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAIHQRTHTGEKPYTCLECNRRFRQ
RXXXXPTALVIHQRIHTGEKPYPCPDCERRFSSSSRLVSHRRVHSGERPYACEHCEARFS
QRSTLLQHQLLHTGEKPYPCPDCGRAFRRSGSLAIHRSTHTEEKLHACDDCGRRFAYPSL
LASHRRVHSGERPYACDLCSKRFAQWSHLAQHQLLHTGEKPFPCLECGRCFRQRWSLAVH
KCSPKAPNCSPRSAVGGSSQRGNAH
Download sequence
Identical sequences ENSGGOP00000026354 ENSGGOP00000026354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]