SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026471 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026471
Domain Number 1 Region: 873-933
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000095
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026471
Domain Number - Region: 168-296
Classification Level Classification E-value
Superfamily Tropomyosin 0.00399
Family Tropomyosin 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026471   Gene: ENSGGOG00000004054   Transcript: ENSGGOT00000033724
Sequence length 943
Comment pep:known_by_projection chromosome:gorGor3.1:9:83745774:83776375:1 gene:ENSGGOG00000004054 transcript:ENSGGOT00000033724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGIGNKRAAGEPGTSMPPEKKAAVEDSGTTVETIKLGGVSSTEELDIRTLQTKNRKLAE
MLDQRQAIEDELREHIEKLERRQATDDASLLIVNRYWSQFDENIRIILKRYDLEQGLGDL
LTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFSFLATLASSSSEEMESQLQERVES
SRRAVSQIVTVYDKLQEKVELLSRKLNSGDNLMVEEAVQELNSFLAQENMRLQELTDLLQ
EKHRTMSQEFSKLQSKVETAESRVSVLESMIDDLQWDIDKIRKREQRLNRHLAEVLERVN
SKGYKVYGAGSSLYGGTITINARKFEEMNAELEENKELAQNRLCELEKLRQDFEEVTTQN
EKLKVELRSAVEQVVKETPEYRCMQSQFSVLYNESLQLKAHLDEARTLLHGTRGTHQHQV
ELIERDEVSLHKKLRTEVIQLEDTLAQVRKEYEMLRIEFEQTLAANEQAGPINREMRHLI
SSLQNHNHQLKGEVLRYKRKLREAQSDLNKTRLRSGSALLQSQSSTEDPKDEPAELKPDS
EDLSSQSSASKASQEDANEIKSKRLKESEKERDSAKDKEKGKHDDGRKKEAEIIKQLKIE
LKKAQESQKEMKLLLDMYRSAPKEQRDKVQLMAAEKKSKAELEDLRQRLKDLEDKEKKEN
KKMADEDALRKIRAVEEQIEYLQKKLAMAKQEEEALLSEMDVTGQAFEDMQEQNIRLMQQ
LREKDDANFKLMSERIKSNQIHKLLKEEKEELADQVLTLKTQVDAQLQVVRKLEEKEHLL
QSNIGTGEKELGLRTQALEMNKRKAMEAAQLADDLKAQLELAQKKLHDFQDEIVENSVTK
EKDMFNFKRAQEDISRLRRKLETTKKPDNVPKCDEILMEEIKDYKARLTCPCCNMRKKDA
VLTKCFHVFCFECVKTRYDTRQRKCPKCNAAFGANDFHRIYIG
Download sequence
Identical sequences ENSGGOP00000026471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]