SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026535 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026535
Domain Number 1 Region: 136-313
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.03e-24
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0057
Further Details:      
 
Domain Number 2 Region: 86-130
Classification Level Classification E-value
Superfamily TGS-like 0.0000883
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026535   Gene: ENSGGOG00000002048   Transcript: ENSGGOT00000026923
Sequence length 353
Comment pep:known_by_projection chromosome:gorGor3.1:21:13883195:13902899:-1 gene:ENSGGOG00000002048 transcript:ENSGGOT00000026923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEALAMGSRALRLWRVAPGGGISWRFIATSPASQLSPTELTEMRNDLFNKEKARQLSLTP
RTEKIEVKHVGKTDPATVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLT
ESCEIKFLTFKDRDPGEVNKAYWRSCAMMMGCVIERAFKDEYMVNLVRAPEVPVISGAFC
YDVVLDSKLDEWMPTKENLRSFTKDAHALIYKDLPFETLEVEAKVALEIFQHSKYKIDFI
EEKASQNSERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGV
SLPVHLRAHFTIWDKLLERSRKMTPFPILFLFTTQSFFTTSPESYLLHGTVSE
Download sequence
Identical sequences G3QI21
ENSGGOP00000018345 ENSGGOP00000002017 ENSGGOP00000026535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]