SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026594 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026594
Domain Number 1 Region: 569-616
Classification Level Classification E-value
Superfamily RING/U-box 2.1e-20
Family RING finger domain, C3HC4 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026594   Gene: ENSGGOG00000000885   Transcript: ENSGGOT00000034781
Sequence length 624
Comment pep:known_by_projection chromosome:gorGor3.1:X:71727709:71757834:-1 gene:ENSGGOG00000000885 transcript:ENSGGOT00000034781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGEST
EEELLRRLQQIKEGPPPQNSDENRGGDSSDDVSNGDSIIDWLNSVRQTGNTTRSGQRGNQ
SWRAVSRTNPNSGDFRFSLEINVNRNNGSQNSENENEPSARRSSGENVENNSQRQVENPR
SESTSARPSRSERNSTEALTEVPPTRGQRRARSRSPDHRRTRARAERSRSPLHPMSEIPR
RSHHSISSQTFEHPLVNETEGSSRTRHHVTLRQQISGPELLSRGLFAASGTRNASQGAGS
SDTAASGESTGSGQRPPTIVLDLQVRRVRPGEYRQRDSIASRTRSRSQTPNNTVTYESER
GGFRRTFSRSERAGVRTYVSTIRIPIRRILNTGLSETTSVAIQTMLRQIMTGFGELSYFM
YSDSDSEPTGSVSNRNMERAESRSGRGGSGGGSSSGSSSSSSSSSSSSSSSSSSSSPSSS
SGGESSETSSDLFEGSNEGSSSSGSSGARREGRHRAPVTFDESGSLPFLSLAQFFLLNED
DDDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRW
LSENSTCPICRRAVLASGNRESVV
Download sequence
Identical sequences G3QF09 Q9NVW2
NP_057204.2.87134 NP_057204.2.92137 NP_899196.1.87134 NP_899196.1.92137 XP_004064457.1.27298 XP_004064458.1.27298 ENSGGOP00000026594 ENSP00000253571 ENSP00000328059 ENSGGOP00000000868 9606.ENSP00000253571 ENSP00000253571 gi|34452684|ref|NP_057204.2| gi|34452686|ref|NP_899196.1| ENSP00000253571 ENSP00000328059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]