SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026685 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026685
Domain Number 1 Region: 305-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-25
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 193-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 5-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-22
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 4 Region: 249-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 154-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 346-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000409
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026685   Gene: ENSGGOG00000025938   Transcript: ENSGGOT00000034675
Sequence length 402
Comment pep:known_by_projection chromosome:gorGor3.1:19:54937009:54951698:1 gene:ENSGGOG00000025938 transcript:ENSGGOT00000034675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEMNPAQGRVVFEDVAIYFSQEEWGHLDEAQRLLYRDVMLENLALLSSLGCCHGAEDEE
APLEPGVSVGVSQVMAPKPCLSTQNTQPCETCSSLLKDILRLAEHGGTHPEQGLYTCPAR
LHQHQKEQIREKLSRGDGGRPTFVKNHRVHMAGKTFLCSECGKAFSHKHKLSDHQKIHTG
ERTYKCSKCGILFMERSTLNRHQRTHTGERPYECNECGKAFLCKSHLVRHQTIHSGERPY
ECSECGKLFMWSSTLITHQRVHTGKRPYGCSECGKFFKCNSNLFRHCRIHTGKRSYGCSE
CGKFFMERSTLSRHQRVHTGERPYECNECGKFFSLKSVLIQHQRVHTGERPYECSECGKA
FLTKSHLICHQTVHTAAKQCSECGKFFRYNSTLLRHQKVHTG
Download sequence
Identical sequences G3SF01
ENSGGOP00000026685 XP_004061588.1.27298 ENSGGOP00000026685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]