SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026746 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026746
Domain Number 1 Region: 219-285
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000818
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000179
Further Details:      
 
Domain Number 2 Region: 288-360
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026746
Domain Number - Region: 61-119
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0851
Family Chromo barrel domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026746   Gene: ENSGGOG00000009957   Transcript: ENSGGOT00000022213
Sequence length 625
Comment pep:known_by_projection chromosome:gorGor3.1:3:182176598:182220698:1 gene:ENSGGOG00000009957 transcript:ENSGGOT00000022213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAELIPEMFQGCTFTFANSQGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKK
EISEGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQ
NKTVKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEAT
VKRVNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFHEEFVVREDLMGLAIGTH
GSNIQQARKVPGVTAIELDEDTGTFRIYGESADAVKKARGFLEFVEDFIQVPRNLVGKVI
GKNGKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAY
LKEVEQLRMERLQIDEQLRQIEGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERK
DELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVLKDPDSNP
YSLLDNTESDQTADTDASESHHSTNRRRRSRRRRTDEDAVLMDGMTESDTASVNENGLVT
VADYISRAESQSRQRNLPRETLAKNKKEMAKDVIEEHGPSEKAINGPTSASGDDISKLQR
TPGEEKINTLKEENTQEAAVLNGVS
Download sequence
Identical sequences ENSGGOP00000026746 ENSGGOP00000026746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]