SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026787 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026787
Domain Number 1 Region: 58-122
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000146
Family Ngr ectodomain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026787   Gene: ENSGGOG00000025760   Transcript: ENSGGOT00000027302
Sequence length 206
Comment pep:known_by_projection chromosome:gorGor3.1:22:3267717:3268639:1 gene:ENSGGOG00000025760 transcript:ENSGGOT00000027302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGPRGALSLLLLLLAPPSRPAAGCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTEL
VLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVA
PPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRA
RARARAAARLSLTDPLVAERAGTDES
Download sequence
Identical sequences G3SFA3 P13224
ENSGGOP00000026787 ENSP00000383382 NP_000398.1.87134 NP_000398.1.92137 ENSP00000383382 gi|4504073|ref|NP_000398.1| 9606.ENSP00000383382 ENSGGOP00000026787 ENSP00000383382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]