SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026790 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026790
Domain Number 1 Region: 651-832
Classification Level Classification E-value
Superfamily Sec7 domain 1.7e-60
Family Sec7 domain 0.00000534
Further Details:      
 
Domain Number 2 Region: 501-587,914-950,1155-1499
Classification Level Classification E-value
Superfamily ARM repeat 6.53e-20
Family HspBP1 domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026790   Gene: ENSGGOG00000022243   Transcript: ENSGGOT00000034306
Sequence length 1816
Comment pep:known_by_projection chromosome:gorGor3.1:8:65481148:65584484:-1 gene:ENSGGOG00000022243 transcript:ENSGGOT00000034306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEIKAETEKQSPPHGEAKAGSSTLPPVKSKTNFIEADKYFLPFELACQSKCPRIVSTSLD
CLQKLIAYGHLTGNAPDSTTPGKKLIDRIIETICGCFQGPQTDEGVQLQIIKALLTAVTS
QHIEIHEGTVLQAVRTCYNIYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQME
KERHRQHHHLLQSPVSHHEPESPQLRYLPPQTVDHISQEHEGDVDLHTNDVDKSLQDDTE
PENGSDISSAENEQTEADQATAAETLSKNDVLYDGENHDCEEKPQDIVQNIVEEMVNIVV
GDMGEGTTINASADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQ
ESGNSSGPSPGAKFSHILQKDAFLVFRSLCKLSMKPLSDGPPDPNSHDSDNKLLSYLSLY
EKLFNLGHIFGQETIFGAYMIRYSLCTTFQENICEDSIPKIFSSLSLPVYVIYFNTFKSE
NSYLSQVFFKEIFLYILETSTSSFDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANI
FERLVNDLSKIAQGRGSQELGMSNVQELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQT
TLGKEKPSEQEMSEIKHPETINRYGSLNSLESTSSSGIGSYSTQMSGTDNPEQFEVLKQQ
KEIIEQGIDLFNKKPKRGIQYLQEQGMLGTTPEDIAQFLHQEERLDSTQVGEFLGDNDKF
NKEVMYAYVDQHDFSGKDFVSALRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLF
ASADTAYVLAYSIIMLTTDLHSPQFYNKRYKGFFVSVLRCLKQSRDLPLAYFWQFSQSSS
PSGLLLSSMMTSILRLYKGTSKQNVASEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPF
TSATHLEHVRPMFKLAWTPFLAAFSVGLQDCDDTEVASLCLEGIRCAIRIACIFSIQLER
DAYVQALARFTLLTVSSGITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLEL
AQLIGTGVKPRYISGTVRGREGSLTGTKDQAPDEFVGLGLGVVVGGNVDWKQIASIQESI
GETSSQSVVVAVDRIFTGSTRLDGNAIVDFVRWLCAVSMDELLSTTHPRMFSLQKIVEIS
YYNMGRIRLQWSRIWEVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQ
KDFLRPFEHIMKRNRSPTIRDMVVRCIAQMVNSQAANIRSGWKNIFSVFHLAASDQDESI
VELAFQTTGHIVTLVFEKHFPATIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRHCAKY
VSDRPQAFKEYTSDDMNVAPEDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMK
TYGHTYEKHWWQDLFRIVFRIFDNMKLPEQQTEKAEWMTTTCNHALYAICDVFTQYLEVL
SDVLLDDIFAQLYWCVQQDNEQLARSGTNCLENVVILNGEKFTLEIWDKTCNCTLDIFKT
TIPHALLTWRPNSGETAPPPPSPVSEKPLDTISQKSVDIHDSIQPRSVDNRPQAPLVSAS
AVNEEVSKIKSTAKFPEQKLFAALLIKCVVQLELIQTIDNIVFFPATSKKEDAENLAAAQ
RDAVDFDVRVDTQDQGMYRFLTSQQLFKLLDCLLESHRFAKAFNSNNEQRTALWKAGFKG
KSKPNLLKQETSSLACGLRILFRMYMDESRVSAWEEVQQRLLNVCSEALSYFLTLTSESH
REAWTNLLLLFLTKVLKISDNRFKAHASFYYPLLCEIMQFDLIPELRAVLRRFFLRIGVV
FQISQPPEQELGINKQ
Download sequence
Identical sequences ENSGGOP00000026790 ENSGGOP00000026790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]