SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027064 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027064
Domain Number 1 Region: 319-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-28
Family SPRY domain 0.068
Further Details:      
 
Domain Number 2 Region: 155-323
Classification Level Classification E-value
Superfamily ARM repeat 0.000000215
Family HspBP1 domain 0.076
Further Details:      
 
Domain Number 3 Region: 517-568
Classification Level Classification E-value
Superfamily RING/U-box 0.00000135
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027064   Gene: ENSGGOG00000027755   Transcript: ENSGGOT00000033192
Sequence length 576
Comment pep:known_by_projection chromosome:gorGor3.1:16:47100432:47135757:1 gene:ENSGGOG00000027755 transcript:ENSGGOT00000033192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVFGWAVFLASRSLGQGLLLTLEEHIAHFLGTGGAATTMGNSCICRDDSGTDDGVDTQQ
QQAENSAVPTADTRSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQE
PPYSMITLHEMAETDEGWLDVVQSLIRVIPLEDPLGPAVITLLLDECPLPTKDALQKLTE
ILNLNGEVACQDSSHPAKHRNTSAVLGCLAEKLAGPASIGLLSPGILEYLLQCLKLQSHP
TVMLFALIALEKFAQTSENKLTISESSISDRLVTLESWANDPDYLKRQVGFCAQWSLDNL
FLKEGRQLTYEKVNLSSIRAMLNSNDVSEYLKISPHGLEARCDASSFESVRCTFCVDAGV
WYYEVTVVTSGVMQIGWATRDSKFLNHEGYGIGDDEYSCAYDGCRQLIWYNARSKPHIHP
CWKEGDTVGFLLDLNEKQMIFFLNGNQLPPEKQVFSSTVSGFFAAASFMSYQQCEFNFGA
KPFKYPPSMKFSTFNDYAFLTAEEKIILPRHRRLALLKQVSIRENCCSLCCDEVADTQLK
PCGHSDLCMDCALQLETCPLCRKEIVSRIRQISHIS
Download sequence
Identical sequences G3SG28
XP_004057749.1.27298 ENSGGOP00000027064 ENSGGOP00000027064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]