SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027232 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027232
Domain Number 1 Region: 392-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 437-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 157-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000628
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027232   Gene: ENSGGOG00000003024   Transcript: ENSGGOT00000031741
Sequence length 542
Comment pep:known_by_projection chromosome:gorGor3.1:3:45705025:45708448:1 gene:ENSGGOG00000003024 transcript:ENSGGOT00000031741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRPQDTVAYEDLSVDYTQKKWKGLTLSQRALQWNMMPENHYSMASLGENVMKGSELTPK
QEIFKGSESSNRTSGGLFGVVPGAAETGDVCEDTFKELEGQTSDEEGSRLENDFLEITDE
DKKKSTKDRYDKYKEVGEHPHLSSSPVEHEGVLKGQKSYRCDECGKAFNRSSHLIGHQRI
HTGEKPYECNECGKTFRQTSQLIVHLRTHTGEKPYECIECGKAYRHSSHLIQHQRLHNGE
KPYKCNECAKAFTQSSRLIDHQRTHTGEKPYECNECGEAFIRSKSLARHQVLHTGKKPYK
CNECGRAFCSNRNLIDHQRIHTGERPYECSECGKAFSRSKCLIRHQSLHTGEKPYKCSEC
GKAFNQNSQLIEHERIHTGEKPFECSECGKAFGLSKCLIRHQRLHTGEKPYKCNECGKSF
NQNSHLIIHQRIHTGEKPYECNECGKVFSYSSSLMVHQRTHTGEKPYKCNDCGKAFSDSS
QLIVHQRVHTGENLMNVVNVGKPLVSVPLLITTSELTLERSPQVWLGQFLKVWFSETESK
DL
Download sequence
Identical sequences ENSGGOP00000027232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]