SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027326 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027326
Domain Number 1 Region: 45-164
Classification Level Classification E-value
Superfamily PX domain 2.62e-16
Family PX domain 0.0039
Further Details:      
 
Domain Number 2 Region: 246-300
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000255
Family SAM (sterile alpha motif) domain 0.0059
Further Details:      
 
Domain Number 3 Region: 834-864
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000366
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027326   Gene: ENSGGOG00000026113   Transcript: ENSGGOT00000027466
Sequence length 888
Comment pep:known_by_projection chromosome:gorGor3.1:16:78029400:78084710:-1 gene:ENSGGOG00000026113 transcript:ENSGGOT00000027466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QITPRTEAPVSSVSNSLENALHTSAHSTEESLPKRPLGKHSKVSVEKIDLKGLSHTKNDR
NVECSFEVLWSDSSITSVTKSSSEVTEFISKLCQLYPEENLEKLIPCLAGPDAFYVERNH
VDLDSGLRYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSGRPV
CGVAGIPSSQSGAQHHGQHPAGSAAPLPHCSHAGSAGSALAYRTQMDTSPAILMPSSLQT
PQTQEQNGILDWLRKLRLHKYYPVFKQLSMEKFLSLTEEDLNKFESLTMGAKKKLKTQLE
LEKEKSERRCLNPSAPPLVTSSGVARVPPTSHVGPVQSGRGSHAAELRVEVEQPHHQLPR
EGSSSEYSSSSSSPMGVQAREESSDSAEENDRRVEIHLESSDKEKPVMLLNHFTSSSARP
TAQVLPVQNEASSNPSGHHPLPPQMLSAASHIAPIRMLNSVHKPERGSADMKLLSSSVHS
LLSLEERNKGSGPRSSMKVDKSFGSTMMDVLPASAPHQPVQVLSGLSESSSMSPTVSFGP
RTKVVHASTLDRVLKTAQQPALVVETSTAATGTPSTVLHAARPPIKLLLSSSVPADSAIS
GQTSCPNNVQISVPPAIINPRTALYTASTKVAFSAMSSMPVGPLQGGFCANSNTASPSSH
PSTSFANMATLPSCPAPSSSPALSSVPESSFYSSSGGGGSTGNIPASNPQPPAPPQPAPP
PPGCIVCTSCGCSGSCGSSGLTVSYANYFQHPFSGPSVFTFPFLPFSPMCSSGYVSAQQY
GGGSTFPVVHAPYSSSGTPDPVLSGQSTFAVPPMQNFMAGTAGVYQTQGLVGSSNGSSHK
KSGNLSCYNCGATGHRAQDCKQPSMDFNRPGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences ENSGGOP00000027326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]