SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027406 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027406
Domain Number 1 Region: 60-180
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.75e-29
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027406   Gene: ENSGGOG00000025068   Transcript: ENSGGOT00000026042
Sequence length 349
Comment pep:known_by_projection chromosome:gorGor3.1:6:61136732:61787845:-1 gene:ENSGGOG00000025068 transcript:ENSGGOT00000026042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKL
SERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSG
EAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNG
SEDSGRGRGIRGRGIRIAPTAPSRGRGGAIPPPPPPGRGVLTPRGSTVTRGALPVPPVAR
GVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEYDDQTYETYDNSYATQTQSVP
EYYDYGHGVSEDAYDSYAPEEWATTRSSLKAPPQRSARGGYREHPYGRY
Download sequence
Identical sequences G3SH19 H2QT91 Q5VWX1
9598.ENSPTRP00000031290 9606.ENSP00000281156 gi|189217895|ref|NP_689901.2| ENSP00000281156 ENSGGOP00000027406 ENSP00000281156 NP_689901.2.87134 NP_689901.2.92137 XP_001141327.1.37143 XP_018884237.1.27298 ENSPTRP00000031290 ENSGGOP00000027406 ENSP00000281156 ENSPTRP00000031290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]