SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027459 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027459
Domain Number 1 Region: 99-249
Classification Level Classification E-value
Superfamily E set domains 5.04e-25
Family Arrestin/Vps26-like 0.038
Further Details:      
 
Domain Number 2 Region: 16-96
Classification Level Classification E-value
Superfamily E set domains 0.00000651
Family Arrestin/Vps26-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027459   Gene: ENSGGOG00000028284   Transcript: ENSGGOT00000031926
Sequence length 273
Comment pep:known_by_projection chromosome:gorGor3.1:19:4995562:5006856:-1 gene:ENSGGOG00000028284 transcript:ENSGGOT00000031926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEGEECLSTHQPPMSVVKSIELVLPKDRIYLAGSSIKGQVILTLNSTLVDPIVKVELVG
RGYVEWSEEAGASRDYSRNVICNNKADYVHKTKTFPVENPLFVEAEEKVSYNCCRQGTVC
LQIQMEKNTFTPGEKVVFTTEINNQTSKCIKTVVFALYAHIQYEGFTPSAERRSRLDSSE
LLRQEANTPVTRFNTTKVVSTFNLPLLLSVSSSTQDGEIMHTRYELVTTVHLPWSLTSLK
AKVPIIITSASVDSGICQLSEDGVLPVNPDHQN
Download sequence
Identical sequences ENSGGOP00000027459 ENSGGOP00000027459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]