SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027590 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027590
Domain Number 1 Region: 1028-1269
Classification Level Classification E-value
Superfamily RNI-like 4.71e-27
Family Cyclin A/CDK2-associated p19, Skp2 0.041
Further Details:      
 
Domain Number 2 Region: 59-183
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.0000000184
Family Asparaginyl hydroxylase-like 0.079
Further Details:      
 
Domain Number 3 Region: 628-695
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000366
Family PHD domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027590   Gene: ENSGGOG00000001636   Transcript: ENSGGOT00000026012
Sequence length 1281
Comment pep:known_by_projection chromosome:gorGor3.1:11:64083654:64138609:1 gene:ENSGGOG00000001636 transcript:ENSGGOT00000026012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LERKKRSIRQERGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGKDFN
VEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIEMTM
AQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVTLIPHSGFLWPPHNQMRCSS
ASPGHLRSYIVYASVKRFYLCLWEEMTKFQIFHFHCGKTYIPLWMYVGNFKLCPRGCHNI
PLAWHWSSLTKVANIYFGDKKKVRCYKSVPGMTQGTEQMSESGRVYPEGKRCSSLNSPAN
KLSCYRNLNILFWNYDLKIYVRPHPRKLSFFFVCLSWVQAYRFFFVKQPRSLLRQEGKQN
GWALCLARSLSLGSPSCHLPLQSISGSCMWVTQQHCSQAQEAAAELKGSRRSPERCTLLP
LENFQYRKQNKDAGETSPRASAAPERRETKGQGVDRQTLSGLGKSAFPSTPTHTPVTESC
IKWKVPVCGQLKVLIILQQPNESLYEGQIQTVATLPPLLLKGTEILLEELANSDPKLALT
GVPIVQWPKRDKKPQASMKPAPRLTPVRPAAASPIVSGARRRRVRCRKCKACVQGECGVC
HYCRDMKKFGGPGRMKQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCIC
NEIVHPGCLQLMDGEGLLNEELPNCWECPKCYQEDSSEKAQRRGSGLRQPAESPALPIPH
AQMCHVEAAPPPERTSAMTLAHRRLTRQDQLWTPTGGDGFPSTSLPRTLARKQGRGQKGI
FLLFISSHLDTKIDGCVLVLPSNTLEKVAPKRWSFSSNHNDKEIHSGLQEKLLYYSRGGW
SGRRSLVESNLDCGRARSQCMLQLIHDPVSPRGMVTRSSPGAGPSDHHSASRDERFKRRQ
LLRLQATERTMVREKENNPSGKKELSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQA
ITASSANLRHSPRVLVQHCPARTPQRDSAEEGGAARLNGRGSWAQDGDESWMQREVWMSV
FRYLSRRELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLSW
TNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIRD
LLTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQS
SNLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIANVTLIDLRGCKQITRKACEHFI
SDLSINSLYCLSDEKLIQKIS
Download sequence
Identical sequences ENSGGOP00000027590 ENSGGOP00000001614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]