SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027696 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027696
Domain Number 1 Region: 18-196
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.62e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000116
Further Details:      
 
Domain Number 2 Region: 191-323
Classification Level Classification E-value
Superfamily E set domains 3.97e-51
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027696   Gene: ENSGGOG00000011810   Transcript: ENSGGOT00000030461
Sequence length 551
Comment pep:known_by_projection chromosome:gorGor3.1:11:62519298:62528643:-1 gene:ENSGGOG00000011810 transcript:ENSGGOT00000030461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS
Download sequence
Identical sequences G3SHV6 Q04206
ENSP00000384273 9606.ENSP00000384273 gi|223468676|ref|NP_068810.3| ENSGGOP00000011529 NP_068810.3.87134 NP_068810.3.92137 XP_018892402.1.27298 ENSGGOP00000027696 ENSP00000384273 ENSP00000311508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]