SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027772 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027772
Domain Number 1 Region: 423-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.19e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 479-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 535-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 311-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 2-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-17
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 7 Region: 256-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000466
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 8 Region: 215-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000583
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027772   Gene: ENSGGOG00000027451   Transcript: ENSGGOT00000027264
Sequence length 606
Comment pep:known_by_projection chromosome:gorGor3.1:11:6994791:6997768:-1 gene:ENSGGOG00000027451 transcript:ENSGGOT00000027264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTFEDVTIIFTWEEWKFLNSSQKRLYREVMWENYTNVMSVENWNESYKSQEEKFRYLE
YENFSCWQGWWNAGAQMYENQNYGETVQGADSKDLTQQDRSQCQEWLILSTQVPGYGNYE
LTFESKSRRNLKYKNFMPWQSLETKTTQDYGREIYMSGSHGFQGGRYRLGISRKNLSMEK
EQKLIVQHSYIPVEEALPQYVGVIGQKDLLRDSMEEKYCGCNKCKEIYYWNSRCVFHKRN
QPGENLYRCSIRKACFSQRSDLYRHPRNHIGKKLYGCDEVDGNFHQSSGVHFHQRVHIGE
VPYSCNACGKSFSQISSLHNHQRVHTEEKFYKIECDKDLSRNSLLHIHQRLHIGEKPFKC
NQCGKSFNRSSVLHVHQRVHTGEKPYKCDECGKGFSQSSNLRIHQLVHTGEKSYKCEDCG
KGFTQRSNLQIHQRVHTGEKPYKCDDCGKDFSHSSDLRIHQRVHTGEKPYTCPECGKGFS
KSSKLHTHQRVHTGEKPYKCEECGKGFSQRSHLLIHQRVHTGEKPYKCHDCGKGFSHSSN
LHIHQRVHTGEKPYQCAKCGKGFSHSSALRIHQRVHAGEKPYKCREYYKGIDHNSHLHNN
HRRGNL
Download sequence
Identical sequences ENSGGOP00000027772 ENSGGOP00000027772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]