SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027893 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027893
Domain Number 1 Region: 32-127
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-27
Family SH2 domain 0.00000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027893   Gene: ENSGGOG00000000044   Transcript: ENSGGOT00000022950
Sequence length 352
Comment pep:known_by_projection chromosome:gorGor3.1:19:16454718:16470108:1 gene:ENSGGOG00000000044 transcript:ENSGGOT00000022950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEAGKLPLPLPPRLDWFVHTQMGQLAQDGVPEWFHGAISREDAENLLESQPLGSFLIRV
SHSHVGYTLSYKAQSSCCHFMVKLLDDGTFMIPGEKVAHTSLEALVTFHQQKPIEPRREL
LTQPCRQKDPANADYEDLFLYSNAVAEEAACPVSATEEASPKPVLCHQSKERKPSAEMNR
ITTKEATSSCPAKAPLGETRQKLWRSLKMLPERGQRVRQQLKSHLATVNLSSLLDVRRST
VISGPGTGKGSQDHSGDPTSGDRGYTDPCVATSLKSPSQPQAPKDRKVPTRKAERSVSCI
EVTPGDMSWHQMVVRALSSQESKPEHQGLADPENDQLPEEYQQPPPFAPGYC
Download sequence
Identical sequences G3SIF3
XP_004060270.1.27298 ENSGGOP00000027893 ENSGGOP00000000043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]