SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027934 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027934
Domain Number 1 Region: 12-91
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.27e-21
Family HLH, helix-loop-helix DNA-binding domain 0.00000571
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027934
Domain Number - Region: 74-129
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0759
Family Phase 1 flagellin 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027934   Gene: ENSGGOG00000026047   Transcript: ENSGGOT00000025462
Sequence length 149
Comment pep:known_by_projection chromosome:gorGor3.1:14:46118097:46144513:-1 gene:ENSGGOG00000026047 transcript:ENSGGOT00000025462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYI
QYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTI
SAFDGGSDSSSESEPEEPQSRKKLRMEAS
Download sequence
Identical sequences ENSGGOP00000027934 ENSGGOP00000027934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]