SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028035 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028035
Domain Number 1 Region: 397-464
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000995
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028035   Gene: ENSGGOG00000016297   Transcript: ENSGGOT00000028452
Sequence length 508
Comment pep:known_by_projection chromosome:gorGor3.1:18:53113009:53164759:-1 gene:ENSGGOG00000016297 transcript:ENSGGOT00000028452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVYINWNITHLVIFYSHKYTVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHS
SDPWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTF
HRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSS
NPSTPVGSPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNH
AVGPSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRG
SHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENL
QDTKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPEQKAEREKERRMANNARERLRVRD
INEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEE
KVSSEPPPLSLAGPHPGMGDASNHMGQM
Download sequence
Identical sequences ENSGGOP00000028035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]