SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028102 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028102
Domain Number 1 Region: 74-153
Classification Level Classification E-value
Superfamily RING/U-box 4.5e-22
Family U-box 0.0000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028102   Gene: ENSGGOG00000021996   Transcript: ENSGGOT00000034202
Sequence length 157
Comment pep:novel chromosome:gorGor3.1:2b:65145658:65146151:1 gene:ENSGGOG00000021996 transcript:ENSGGOT00000034202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSIEEGRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSQVRAQQACIEAKHHDK
YMADMDELFSQVDEKRKKYDIPKYLCCKISFELMRELCITPTGISYDRKDIEEHLQRVDH
FDPVTWSPLTQKQFIPNLAMKEVIDAFISENGWVEDY
Download sequence
Identical sequences ENSGGOP00000028102 ENSGGOP00000028102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]