SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028132 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000028132
Domain Number - Region: 92-171
Classification Level Classification E-value
Superfamily PA domain 0.000536
Family PA domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028132   Gene: ENSGGOG00000011476   Transcript: ENSGGOT00000011520
Sequence length 684
Comment pep:known_by_projection chromosome:gorGor3.1:5:38212090:38216644:-1 gene:ENSGGOG00000011476 transcript:ENSGGOT00000011520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACLGFLLPVGFLLLISTVAWGKYGVAHVVSENWSKDYCLLFSSDYIALPRDLHHAPLLP
LYDGTKAPWCPGEDSPHQAQLRSPSQRPLRQTTAMVMRGNCSFHAKGWLAQGQGAHGLLI
VSRVSDQQCSDTTLAPQDPRQPLADLTIPVAMLQYADMLDILSHTRGEAVVHVAMYAPPE
PIIDYNMLVIFILAVGTVAAGGYWAGLTEANRLQRRRARRGGGPGGHHQPQEAAAAEGAQ
KEDNEDIPVDFTPAMTGVVVTLSCSLMLLLYFFYDHFIYVTIGIFGLGAGIGLYSCLSPL
VCRLPLRQYQRPPHSLWASLPLPLLLLASLCTTVIIFWVAYRNKDRWAWLLQDTLGISYC
LFVLHRVQLPTLKNCSSFLLALLAFDVFFVFVTPFFTKTGESIMAQVALGPAESSSHERL
PMVLKVPQLRVSTLTLCSQPFSILGFGDIVVPGFLVAYCCRFDVQVRSRQVYFVACTMAY
AVGLLVTFMAMVLMQMGQPALLYLVSSTLLTSLAVAACRQELSLFWTGQGRAKMCGLGCA
PSAGSRQKQEGAADAHTASTLERGTSRGAGDLDSNPGEDTTEIVTISENEATNPEDHSDS
SEGWSDAHLDPNELPFIPPGASEELMPLMPMAMLIPLMPLMPPPSELGHVLAQAQAHETG
LPWAGLHKRKGLKVRKSMSTQAPL
Download sequence
Identical sequences G3SJ42
ENSGGOP00000028132 XP_004041550.1.27298 ENSGGOP00000021935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]