SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028179 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028179
Domain Number 1 Region: 317-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 205-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 360-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 6-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.2e-19
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 420-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000103
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 7 Region: 174-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000114
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028179   Gene: ENSGGOG00000023933   Transcript: ENSGGOT00000023024
Sequence length 514
Comment pep:known_by_projection chromosome:gorGor3.1:19:54845652:54857170:1 gene:ENSGGOG00000023933 transcript:ENSGGOT00000023024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAWMAPAQESVTFEDVAVTFTQEEWGQLDVTQRALYVEVMLETCGLLVALGDSTKPET
VEPIPSHLALPEEVSLQEQLAQGVPRYSYLGQAMDQDGPSEMQEYFLRPGTDPQSEKLHG
KMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNEN
CFLVQHEQILPRVKPYDCPECGKAFGKSKHLLQHHIIHTGEKPYKCLECGKDFNRRSHLT
RHQRTHNGDKPFVCSECGRTFNRGSHLTRHQRVHSGEKPFVCNECGKAFTYRSNFVLHNK
SHNEKKPFACSECGKGFYESTALIQHFIIHTGERPFKCLECGKAFNCRSHLKQHERIHTG
EKPFVCSQCGKAFTHYSTYVLHERAHTGEKPFECKECGKAFSIRKDLIRHFNIHTGEKPY
IHTGEKPYECVECGKAFNRRSPLTRHQRIHTAEKSHEPIQSGNVSCESTDLIQHSIIHTE
SSPVSAVNMETPSIAAHSSSLDINGFIVEETLQL
Download sequence
Identical sequences ENSGGOP00000028179 ENSGGOP00000028179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]