SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028312 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028312
Domain Number 1 Region: 181-445
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.27e-86
Family Nuclear receptor ligand-binding domain 0.000000000137
Further Details:      
 
Domain Number 2 Region: 94-159
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-16
Family Nuclear receptor 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028312   Gene: ENSGGOG00000016781   Transcript: ENSGGOT00000034445
Sequence length 446
Comment pep:known_by_projection chromosome:gorGor3.1:6:36395646:36410079:1 gene:ENSGGOG00000016781 transcript:ENSGGOT00000034445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTALCFLLSPATSLLTQVL
QACTSSSSSLLPLEQDRLCPTQPEGQPEAAGCLFACELCQGFFRRTIRMKLEYEKCERSC
KIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADL
KAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGL
PPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLA
SIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAI
ILCGDRPGLMNVPQVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQ
MMQRIKKTETETSLHPLLQEIYKDMY
Download sequence
Identical sequences ENSGGOP00000016373 ENSGGOP00000028312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]