SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028662 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028662
Domain Number 1 Region: 238-386
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-41
Family Dual specificity phosphatase-like 0.000000517
Further Details:      
 
Domain Number 2 Region: 52-188
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1e-25
Family Cell cycle control phosphatase, catalytic domain 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028662   Gene: ENSGGOG00000034971   Transcript: ENSGGOT00000041011
Sequence length 419
Comment pep:known_by_projection chromosome:gorGor3.1:5:23522518:23525734:1 gene:ENSGGOG00000034971 transcript:ENSGGOT00000041011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNQLRGPPARAHMSTSGAAAAGGTRAGSEPGAGSGSGAGTGAGAATGAGAMPCKSAEWL
QEELAARVGASLLLLDYRPHELFESSHIETAINLAIPGLMLRRLRKGNLPIRSIIPNHAD
KERFATRCKAATVLLYDEATAEWQPEPGAPASVLGLLLQKLRDDGCQAYYVQGGFNEFQT
EYSEHCETTVDSSSSPSSSPPTSVLGLGGLRISSDCSDGESDRELPSSATESDGSPVPSS
QPAFPVQILPYLYLGCAKDSTNLDVLGKYGIKYILNVTPNLPNAFEHGGEFTYKQIPISD
HWSENLSQFFPEAISFIDEARSKKCGVLVHCLAGISRSVTVTVAYLMQKMNLSLNDAYDF
VKRKKSNISPNFNFMGQLPDFERTLGLSSPCDNHASSEQLYFSTPTNHNLLPLNTLEST
Download sequence
Identical sequences ENSGGOP00000028662 ENSGGOP00000028662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]