SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|104147|e_gw1.2.52.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|104147|e_gw1.2.52.1
Domain Number 1 Region: 94-346
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.4e-79
Family Eukaryotic proteases 0.0003
Further Details:      
 
Domain Number 2 Region: 20-56
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000114
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 58-100
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|104147|e_gw1.2.52.1
Sequence length 401
Sequence
MIYTHYVDIVHSFSLVASNDCEFDWLPCGSNGNCIPKEWFCDGEQDCFDNKDENNCESCK
MGEIPCHDGSCLPQYQRCDGIPQCTDAEDEDECKCQEKVCGIVSDTIPQAFIVGGSQSAI
GEWPWMVAVMSGDKHRCGGTIISDQWILTAGHCINDIQHSPQTTSIIAGATNLKANDVQY
RKVSEMILHPQYSFIYSADLGLMRLRQPLVFSNTIRPLCLPARLHTWSPSLPCYIAGWGA
TNNQGEFSTERYMVQDVGLKVWPKSKCEMAYPNKTKDSMVCAGYKYGHIDACKGDSGGPL
MCKVGSENDWVIVGITSWGEGCGGVNKPGVYTRVDYYRQWVQQLTQRTGKNSSIEQWTRR
TQWRFCGGGWTVTYLGNLGEGAEHGPQNFSGGGGTGYTSTM
Download sequence
Identical sequences V4AWP1
XP_009051786.1.39240 jgi|Lotgi1|104147|e_gw1.2.52.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]