SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|105064|e_gw1.3.112.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|105064|e_gw1.3.112.1
Domain Number 1 Region: 14-64
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000132
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 2 Region: 94-146
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000449
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 50-109
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000777
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|105064|e_gw1.3.112.1
Domain Number - Region: 164-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00051
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|105064|e_gw1.3.112.1
Sequence length 192
Sequence
LKTHKKHHFLEAKHICDICGRAFKTPSNLKSHQLSHSGVRNFSCSICNMAFIHKASLKKH
LRTHDSNRKVVQCNLCSKIFKNRTNLNRHNITAHSDLKPFQCEFCSKTFKLKSLLDQHAN
LHKLEKNYSCKYCDKKFAFNSSLYSHVKCHHKEKLNVSDLETGVKCYLCGNFFESNFALA
SHVRTHNNNVAI
Download sequence
Identical sequences V4BXX5
XP_009055565.1.39240 jgi|Lotgi1|105064|e_gw1.3.112.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]