SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|105163|e_gw1.3.537.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|105163|e_gw1.3.537.1
Domain Number 1 Region: 1935-2061
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-30
Family Cadherin 0.0004
Further Details:      
 
Domain Number 2 Region: 2668-2792
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-30
Family Cadherin 0.00061
Further Details:      
 
Domain Number 3 Region: 670-793
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-29
Family Cadherin 0.00054
Further Details:      
 
Domain Number 4 Region: 2362-2466
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-28
Family Cadherin 0.00056
Further Details:      
 
Domain Number 5 Region: 3418-3530
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-27
Family Cadherin 0.00097
Further Details:      
 
Domain Number 6 Region: 1192-1310
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-27
Family Cadherin 0.00042
Further Details:      
 
Domain Number 7 Region: 1405-1537
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-27
Family Cadherin 0.00098
Further Details:      
 
Domain Number 8 Region: 2250-2370
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 9 Region: 568-675
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-27
Family Cadherin 0.00071
Further Details:      
 
Domain Number 10 Region: 3096-3206
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-26
Family Cadherin 0.0008
Further Details:      
 
Domain Number 11 Region: 2150-2254
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-26
Family Cadherin 0.00037
Further Details:      
 
Domain Number 12 Region: 463-574
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-25
Family Cadherin 0.0016
Further Details:      
 
Domain Number 13 Region: 985-1088
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-24
Family Cadherin 0.0024
Further Details:      
 
Domain Number 14 Region: 3977-4192
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-24
Family Laminin G-like module 0.0063
Further Details:      
 
Domain Number 15 Region: 2047-2148
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 16 Region: 1303-1409
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-23
Family Cadherin 0.0017
Further Details:      
 
Domain Number 17 Region: 3194-3323
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-22
Family Cadherin 0.00078
Further Details:      
 
Domain Number 18 Region: 1839-1939
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 19 Region: 2984-3114
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-22
Family Cadherin 0.0017
Further Details:      
 
Domain Number 20 Region: 231-360
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-22
Family Cadherin 0.0017
Further Details:      
 
Domain Number 21 Region: 3518-3651
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.0013
Further Details:      
 
Domain Number 22 Region: 1090-1204
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-21
Family Cadherin 0.0035
Further Details:      
 
Domain Number 23 Region: 877-984
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-21
Family Cadherin 0.003
Further Details:      
 
Domain Number 24 Region: 2462-2572
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-20
Family Cadherin 0.0011
Further Details:      
 
Domain Number 25 Region: 127-243
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-20
Family Cadherin 0.0013
Further Details:      
 
Domain Number 26 Region: 2575-2680
Classification Level Classification E-value
Superfamily Cadherin-like 9.85e-20
Family Cadherin 0.0029
Further Details:      
 
Domain Number 27 Region: 2780-2885
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-19
Family Cadherin 0.00068
Further Details:      
 
Domain Number 28 Region: 350-461
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-19
Family Cadherin 0.0013
Further Details:      
 
Domain Number 29 Region: 4209-4425
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-19
Family Laminin G-like module 0.022
Further Details:      
 
Domain Number 30 Region: 2878-2988
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-17
Family Cadherin 0.0019
Further Details:      
 
Domain Number 31 Region: 781-889
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-16
Family Cadherin 0.0034
Further Details:      
 
Domain Number 32 Region: 3309-3415
Classification Level Classification E-value
Superfamily Cadherin-like 6e-16
Family Cadherin 0.0042
Further Details:      
 
Domain Number 33 Region: 1518-1633
Classification Level Classification E-value
Superfamily Cadherin-like 9.85e-16
Family Cadherin 0.0028
Further Details:      
 
Domain Number 34 Region: 1732-1823
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000271
Family Cadherin 0.0092
Further Details:      
 
Domain Number 35 Region: 1632-1728
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000243
Family Cadherin 0.0036
Further Details:      
 
Domain Number 36 Region: 3921-3959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000101
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 37 Region: 63-133
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000171
Family Cadherin 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|105163|e_gw1.3.537.1
Domain Number - Region: 3880-3921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000215
Family EGF-type module 0.0091
Further Details:      
 
Domain Number - Region: 3625-3722
Classification Level Classification E-value
Superfamily Cadherin-like 0.00942
Family Cadherin 0.018
Further Details:      
 
Domain Number - Region: 3824-3887
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00974
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|105163|e_gw1.3.537.1
Sequence length 4946
Sequence
MVSKFHTSIPHRTKHRIIYLLLLHFLVEFAQGNGPGDDRVNFETTEGLPPGTTLGVIPTR
SGYTYQLDRPNKYFVLNSSSGVLVNKLVLDRDTSQFSQDVINLFALGSKSQNPPHPVEIL
IKILDINDNRPVFQEQAMNISFGENAKGAQHIIVTATDIDLSENGTVSQYDIISGNHEGK
FQLIVPSSSSPFMYIEVIGDLDRELKDQYILNISARDNGIPPLYGFLSVNISVSDVNDNP
PIFNPSEYKKKILEDAKIGQSVIRVIASDADSGLNKEIVYSLLDETGQFMIEEKTGIVRT
LTKPLKCSRVCGRSLSCSPYSCLLTVIAEDRGTPALSDQAYISVSIVDTNDHSPVIIFDH
VPDNSKDYSSVDENTEPGKRVASISVQDADTGINSETSIQITRGNELGHFKLFSFFTLNI
IRVAGHLDREKLNFYNLTVVATDKGIPPRSSTAFLIIKINDANDHAPVFERSEYSVELQE
TSLPESFVASVKATDLDSGLNSDLVYTIEDGNSNGWFKIDSGTGLMTIQSPLDHEIMSSV
KMNVSARDGGSQPFVSFTQVSVVILDENDEIPTFNQSVYPINMEENLASGIEVVTIKAED
RDRGINGTIKYSFHPDVHGQYPNTFTLDQNSGKITTLKSFDRESVSAYTLKLIARDQGIP
SLSSTTTINIRVLDVNDNTPKFYPDIIYGNIQENRQSGTEVVRVAAVDPDEGENGRITYS
IVGNDFNSFQIDSGTGWIRTTRQLNRNAGKKYDLVIRAVDGKGRSATNDASVKISVTAVD
EVAPVFRKRSYAFEIDEDGDDARNQIGRRVGVVSASSTTGSPAYSIAGGDQFGVFSINDQ
TGEITTNKKIDREEKDEYDLKVLAIGPSKFRQVIVTVKVKDINDNSPRFRSSAMSVEVIE
DWPIGHNIFLAEAIDADDGVNGKVTYRLQTSSDYFGIKSPTGVIYLKKAVVNLPVSSFDL
KIIATDGGSPQKSSLLELHINIIDVNDHTPVFQKNQYEVSIYESKPVNEIIFQLLATDDD
KGKNSEMFFKIIRGNDHNRFGIFPDGTLYVAHQLDREEHDLYMVTVVVCDRGESPRSSTS
NITINILDDNDNTPVFMNSTFHFYVSENQPSLSYIGQVMAKDADSGPNAELTFWGDGQKN
FTIDAPTGRIYTARQFNREYVLKTTNNDFFSFYIYVKDNGRKPNQARALIKVHIQDENDN
PPVFPRHIYTASVMEDSGPNTNITIVTAVDADDGPNAVIKYSISESDSDLKFNIREATGQ
IYLTGKINREEQSSYTLVVTATDSGDTVQHSSSTTVIISVADINDNKPVSKSAAFQKSVD
LSESVPLGYHITTFTAIDADSGNNAVLFFNIVSGNNDNTFNIDAYSGRMYLTRTLDYERK
AQYDLEISVSDAGSPSLSTTHNFIVQVMDANDNIPVFQDTSSSVTISESKRVNSSVTIVR
ATDKDSGGNGRVQYIIAKQEPVPDHAPNHFRIDVFSGEIFIQREIDREQTDKFFLTIIAT
DMAVPVYKRLSAMKTITIIVTDINDHAPVFESMNAMVVPARSKRGYKIGTVLARDQDAGN
NGLVAYQMVAGDTSLFSLQSTTGELTLSQDLPASAIYHTITVQAQDDGGRDVLGQKSTRM
EMTIIISSSNDGPIFTNIKAGNIEENEPPGKGVTNIQASATQSGVNVEYYVTKILANSVP
QPRYFSIDKLNGLMKTTQVLDREYLPEIFEVEVTAIEVGGSSPKTRSTKVQVRLGDQNDT
PPRFSSQWYIINVPVDQDRETSFFKVNVDDPDTVGDVVIDYFDMDDGKFSFISSFSGALF
LNESLQYHNKSVFKFKLQANDGIQTSEAIVEVHAINHKPVFEKSYYSFEVPEDASTGTTI
ANIAATDLDEGPEGHVTYELQSDWGKDKFRLDANFGTFTLIDRLDFEEIQMYGLMAIAKD
GSIPPRSATVSVFMSVKDINDNPPEFDQSEYKEEVAENAVVGTTVIDVIANDKDTGRNAE
VQYSLIGGDELGQFGIGPVNGTIYTTAKLDREAIRQYTLLVLAIDQSTDVTQRLSSTGTV
VITLKDVNDSPPEFVTPSTIFVREDSQRYTTVYTIVAHDKDEGDNSKIDYSLSSGSSMFT
IESSTGNVKVTQPLDRETRSNYSIQVMARDQGTPQFSATLDLVIQIEDANDNAPKFDDQS
YTKTVAENISIGTSLLKVSATDRDEGLNGVVRYLIIAGDENYDFNMDLSSGVLRVQKALD
FEEVKSYTLTVMAVDSSVGLTLNSTVKVTITVTDINDFEPIFVNSPYYAYVQENMNQLPV
PVLTISARDNDSGSNSRLIYDIRSEEEEQKIFSMNSQTGEITANLMLDREKKQEYELIIV
AFDGGHPRLTGSGLVTVYVKDVNDHAPVFESYGPYTGHVTENMPPETSVLTVQATDADEE
NNAEIIYSLEDTADGKFSILPKTGEIVTLERLDREVEDQYYLKVIATDQGIPPLSATSQV
IIYVDDDNDNAPQFEHHNYTQMILDATQTGEFVLGVTALDRDIGNNGKVTYKLEGQDANM
FNINTNTGVVTAAQRLSGNSITFIFSVRATDQGATTKSQVVSVYVKIQRIDDARKPIFSP
FSNNLELKENTNLGFFVTTVRATAPRTGKISYHIAGGNIGHGFTINMNNGTITVAGTLDY
EITDSMNLWIEANDGGNPPVSAYKQLPIRITDVNDNMPRFKQSFYSKNIEENTAKFSTLI
QIEASDADSGNNGHVMFGLTGGNKNNTFRINSNTGVITTNNIIDREGIDLFHLVVEASDM
GSPDKKTSTATVKVTVQDQNDNPPKFTHQFRTSVPEDISVNSFIIQITSTDKDLDSNAIA
SYELLSETNKFAIDRLSGNLSTITKLDAEDRDTYSLQVRAVDESFSVTTYVSLRILDVND
NAPIIYKNTMNFDFHELQAPNTPVGRLSASDIDISSPNNQFFYSLKRPSSLFDVDAETGT
ISALKTMTFIHSEEGPSTANLYQLDVVVTDIGSPPMSSEAQININVVDANNHAPVFEEDS
FTSAVPENSLINDIIIKIVAVDEKDFGINAKVEYDIIGGNGTSYFTIDKLSGEVIVSASL
SGQKNRHYSLLVEARDKGHPVKKASTEVHLQITDVNNYRPEFIGSSFEASIIENLADKIV
GTLRATDDDDGLNGQVQYLITGGDSEKYFTIGKTTGAITTVKKLDYETKKVYSLDITARD
MGLHFKQSSITFTVNVEDENDNSPVFSSTILTGYVPENSPSDTEILQVVAEDADTAPNDV
IHYEIMDTTPDAAIFDIVKDTGMILLKGSVDYESKNTYVITVQAFNPTGSDIPPSLTSDI
QVFIYVTSVNEYRVEFVKKQYAFNVSESAPINTMLGNVQATDLDEGVDKIAYFYFMGSSN
VKGFAIHPLTGVIFINGRPDYESNPQIELVVLVKNRGSVRGNDTDECKVLVGIEDANDPP
VFDQKFYTAFVPENSQADVNILKVSATDYDIQAENRQFTYAILSGNIGGWFWMDRVSGMI
KTTGQGVLDRETTPVYNITVGAIDSGKPPQTGSATVKIELQDVNDNKPIFSPHKLIINFT
ETNVLGSKVVDLSVHTTDPDINPNQGPFQYQEVTNPFSSMFDILPTGIVTIMSAIDRETL
DHYTIPVKVTDNGNPKMTSTLTFTVTVLDANDSPPLERPLKVLLNVLDSSPSGGKIADIR
PLDNDLIGSYSCQIESGSINDFSIPQKCDLVASNNLDTKSHRLSVSGSDGFNGDVNYEVT
VEVEKFSRSTLEDAVALRLSSISIEDFLSNSYSRFTNGLKSLLGNQKTIILFSLQKLESD
ILVFLAVKDIAGDHLSRSDLISFLQNNINNLELATGFVIKETAYSTCHDDMCKNGGSCVY
DILLGKDYDIHNSDNLILTSAVPSFKIKCKCPASFSGPTCEIPVGHCGDTYCYNGGTCDT
SGSQEVCRCTEGWNGPSCQTDKNECNDFPCKNGATCINLDGSFKCKCVSGFHGQYCESSY
YCASIPCQNGGTCNDLDNGFSCDCVFGYFGTRCEKSSVGFEEGSYLEYQAIQDYSSVDMH
VYFATVKENALILFNPVTVDGTDVGYLAMEVVDGFMRFSIKLGSENPTRLQVNTKVTSGK
WFRVDVQTSPDVTILKVVLCDEGSTTCNQCIGQNPSCYDSKPLNFGKNFVNGIQLSIGGI
RNIENILSYSGEIRSHDFIGCMHSFTVNGLNVLDTELAANFKSVTSTCPRRSYKGLCTVK
ECHNSGICVDDWSVARCRCSDKHMGDSCEQAWQPSGFAPNAKVTFKLRESYLRDQQLKTP
SNRKKRAVDSSEVYIRFRTLEETGALFYSSTVDTNCVLWLEDGKIRFVLTPPKAVNDPLN
MEFPIADGDWHNITITSLGSVFAITVDGQRSQPKDFGAGYIFSSLDVKEMVLSGQRIVPP
SGQSIMGFDGCISEFRIDNKKLPFDGKTEKYSITVNGSVESGCKALCLNNPCGDGNTCIV
SGEAFVCKQIAKPSGGLDIGIVVVIVFFIILIIVILIVFILFRRKRSLFPCKGGDKKVTK
SNGVMARDNADSTLRGMPIYGTRNEDLLQNQLTEDVTYQKNSALSSRPDLIGSNFVGRPG
SRPQMFEDGTVIIENGELEHINVQDDEMPEHYDLENASSIAPSDIDVIQHYKQYRNGDTR
YKPNFNKTHHRSRESPLNLRSPSAMSRDSPNVHKFHNNAHTRQSPVSLSGSALSMPSRPN
PHLNTNGINRPASAQAVYMHGTHHRNSPITQLNIRQNPASQHNSSRSSLGSHHSHSTNSS
VPRNNLSKPMRNGKPKHVKGLTVEEINRLNARPGPPSPASMLEAVSSSSDELKRKRKMKP
VEHIDGTILLEPPDSSSSDSGANDSFTCSEFEFENDHRKNDFDPDTMIFSKLTEVENEND
DIPVPIRSNSDGMHSNCDSFTSTIMSSEEHFLPQKGPHGAFNMDSLLNWGPNFDKLVGVF
KDIALLPDSETQPLEGGITTDHEEYV
Download sequence
Identical sequences V3ZQU0
XP_009055414.1.39240 jgi|Lotgi1|105163|e_gw1.3.537.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]